PDB entry 2kwc

View 2kwc on RCSB PDB site
Description: The NMR structure of the autophagy-related protein Atg8
Class: Protein Transport
Keywords: Autophagy, Atg8, Protein Transport
Deposited on 2010-04-05, released 2010-05-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autophagy-related protein 8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38182 (0-115)
      • engineered (25)
    Domains in SCOPe 2.05: d2kwca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kwcA (A:)
    mkstfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqf
    vyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg