PDB entry 2kwb

View 2kwb on RCSB PDB site
Description: Minimal Constraint Solution NMR Structure of Translationally-controlled tumor protein (TCTP) from C.elegans, Northeast Structural Genomics Consortium Target WR73
Class: metal binding protein
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein Structure Initiative, METAL BINDING PROTEIN
Deposited on 2010-04-02, released 2010-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translationally-controlled tumor protein homolog
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: F25H2.11, tct-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93573 (0-180)
      • expression tag (181-182)
    Domains in SCOPe 2.07: d2kwba1, d2kwba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kwbA (A:)
    mliykdiftddelssdsfpmklvddlvyefkgkhvvrkegeivlagsnpsaeegaeddgs
    dehvergidivlnhklvemncyedasmfkayikkfmknvidhmeknnrdkadvdafkkki
    qgwvvsllakdrfknlaffigeraaegaengqvaiieyrdvdgtevptlmlvkeaiieek
    clehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kwbA (A:)
    mliykdiftddelssdsfpmklvddlvyefkgkhvvrkegeivlagsnpsaeegaeddgs
    dehvergidivlnhklvemncyedasmfkayikkfmknvidhmeknnrdkadvdafkkki
    qgwvvsllakdrfknlaffigeraaegaengqvaiieyrdvdgtevptlmlvkeaiieek
    cle