PDB entry 2ku5

View 2ku5 on RCSB PDB site
Description: Mouse Prion Protein (121-231) with mutation D167S
Class: unknown function
Keywords: mPrP_D167S, mouse, prion, protein, Amyloid, Cell membrane, Disulfide bond, Glycoprotein, Golgi apparatus, GPI-anchor, Hydroxylation, Lipoprotein, Membrane, UNKNOWN FUNCTION
Deposited on 2010-02-12, released 2010-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Mus musculus [TaxId:10090]
  Gene: Prnp, Prn-p, Prp
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04925 (1-112)
    • expression tag (0)
    • engineered (47)
  Domains in SCOPe 2.08: d2ku5a1, d2ku5a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ku5A (A:)
  svvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvsqysnqnnfvhdc
  vnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss