PDB entry 2kte

View 2kte on RCSB PDB site
Description: The solution structure of Bacillus subtilis, YndB, Northeast Structural Genomics Consoritum Target SR211
Class: structural genomics, unknown function
Keywords: AHSA1, lipid binding, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2010-01-29, released 2010-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein yndB
  Species: Bacillus subtilis [TaxId:1423]
  Gene: yndB, BSU17730
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31806 (0-143)
    • expression tag (144-151)
  Domains in SCOPe 2.06: d2ktea1, d2ktea2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kteA (A:)
  maqnnenalpditksitleapiqkvwetvstsegiakwfmpndfqlkegqefhlqspfgp
  spckvlavqaptelsfewdtegwvvtfqledlgektgftlihsgwkepnevigkanekss
  vvrgkmdggwtgivnerlrkaveelehhhhhh