PDB entry 2kt3

View 2kt3 on RCSB PDB site
Description: Structure of Hg-NmerA, Hg(II) complex of the N-terminal domain of Tn501 Mercuric Reductase
Class: oxidoreductase
Keywords: NmerA, MerA, mercuric reductase, HMA domain, Mercuric resistance, Mercury, Metal-binding, OXIDOREDUCTASE
Deposited on 2010-01-17, released 2010-09-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mercuric reductase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: merA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2kt3a_
  • Heterogens: HG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kt3A (A:)
    mthlkitgmtcdscaahvkealekvpgvqsalvsypkgtaqlaivpgtspdaltaavagl
    gykatlada