PDB entry 2kt1

View 2kt1 on RCSB PDB site
Description: Solution NMR Structure of the SH3 Domain from the p85beta subunit of Phosphatidylinositol 3-kinase from H.sapiens, Northeast Structural Genomics Consortium Target HR5531E
Class: protein binding
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), Target HR5531E, PSI-2, Protein Structure Initiative, p85beta subunit of PI3K, SH3 domain, Phosphoprotein, Polymorphism
Deposited on 2010-01-15, released 2010-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3R2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00459 (0-79)
      • expression tag (80-81)
    Domains in SCOPe 2.06: d2kt1a1, d2kt1a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kt1A (A:)
    magpegfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpgl
    nertrqrgdfpgtyveflgplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kt1A (A:)
    magpegfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpgl
    nertrqrgdfpgtyveflgple