PDB entry 2ksx

View 2ksx on RCSB PDB site
Description: Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by asymmetric back-protonation and 2D NOESY
Class: antiviral protein
Keywords: interferon, interferon receptor, docking, interferon receptor complex, Cytokine, inter-molecular NOEs, ANTIVIRAL PROTEIN
Deposited on 2010-01-14, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon alpha-2
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ksxa_
  • Chain 'B':
    Compound: Soluble IFN alpha/beta receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNABR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ksxb1, d2ksxb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ksxA (A:)
    cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
    qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
    kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ksxB (B:)
    sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
    ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfeppefeivgftnh
    invmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyiidklipntnyc
    vsvylehsdeqaviksplkctllppgqesefs