PDB entry 2ksq

View 2ksq on RCSB PDB site
Description: The myristoylated yeast ARF1 in a GTP and bicelle bound conformation
Class: transport protein
Keywords: ARF, myristoylated, myristoyl, GTP, bicelle, ER-Golgi transport, Golgi apparatus, GTP-binding, Lipoprotein, Myristate, Nucleotide-binding, Protein transport, Transport, TRANSPORT PROTEIN
Deposited on 2010-01-12, released 2010-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARF1, YDL192W, D1244
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11076 (1-180)
      • see remark 999 (0)
      • see remark 999 (54)
      • see remark 999 (58)
      • see remark 999 (82)
      • see remark 999 (116)
      • see remark 999 (175)
    Domains in SCOPe 2.08: d2ksqa_
  • Heterogens: MTN, GTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ksqA (A:)
    xglfasklfsnlfgnkemrilmvgldgagkttvlyklklgevittiptigfnvecvqycn
    isftvwdvggqdrirslwrhyycntegvifvvdsndrsrigearevmqrmlnedelcnaa
    wlvfankqdlpeamsaaeiteklglhsirnrpwfiqatcatsgeglyeglewlsnclkns
    t