PDB entry 2kso

View 2kso on RCSB PDB site
Description: EphA2:SHIP2 SAM:SAM complex
Class: protein binding
Keywords: SAM domain, heterodimer, cell signaling, Angiogenesis, Apoptosis, ATP-binding, Cataract, Disulfide bond, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, Actin-binding, Cell adhesion, Cytoskeleton, Diabetes mellitus, Hydrolase, Immune response, SH2 domain, SH3-binding, PROTEIN BINDING
Deposited on 2010-01-10, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ksoa_
  • Chain 'B':
    Compound: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: INPPL1, SHIP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ksob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ksoA (A:)
    hhhhhhssglvprgshmtvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvr
    lpghqkriaysllglkdqvntv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ksoA (A:)
    tvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysllglkd
    qvntv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ksoB (B:)
    hhhhhhssglvprgshmgmsawlraigleryeeglvhngwddleflsditeedleeagvq
    dpahkrllldtlqlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ksoB (B:)
    gmsawlraigleryeeglvhngwddleflsditeedleeagvqdpahkrllldtlqlsk