PDB entry 2ksj

View 2ksj on RCSB PDB site
Description: Structure and Dynamics of the Membrane-bound form of Pf1 Coat Protein: Implications for Structural Rearrangement During Virus Assembly
Class: viral protein
Keywords: membrane protein, Capsid protein, Host membrane, Membrane, Transmembrane, Virion, VIRAL PROTEIN
Deposited on 2010-01-05, released 2010-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: NMR;SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein G8P
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Gene: VIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ksja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ksjA (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka