PDB entry 2kro

View 2kro on RCSB PDB site
Description: RDC refined high resolution structure of the third SH3 domain of CD2AP
Class: signaling protein
Keywords: protein, SH3 domain, SIGNALING PROTEIN
Deposited on 2009-12-21, released 2011-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD2-associated protein
    Species: Mus musculus [TaxId:10090]
    Gene: Cd2ap, Mets1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLQ0 (4-63)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2kroa1, d2kroa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kroA (A:)
    gamgakeycrtlfpytgtnedeltfregeiihlisketgeagwwkgelngkegvfpdnfa
    vqis