PDB entry 2kro

View 2kro on RCSB PDB site
Description: RDC refined high resolution structure of the third SH3 domain of CD2AP
Class: signaling protein
Keywords: protein, SH3 domain, SIGNALING PROTEIN
Deposited on 2009-12-21, released 2011-01-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CD2-associated protein
  Species: Mus musculus [TaxId:10090]
  Gene: Cd2ap, Mets1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JLQ0 (4-63)
    • expression tag (0-3)
  Domains in SCOPe 2.05: d2kroa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kroA (A:)
  gamgakeycrtlfpytgtnedeltfregeiihlisketgeagwwkgelngkegvfpdnfa
  vqis