PDB entry 2krn

View 2krn on RCSB PDB site
Description: High resolution structure of the second SH3 domain of CD2AP
Class: signaling protein
Keywords: protein, SH3 domain, SIGNALING PROTEIN
Deposited on 2009-12-21, released 2011-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD2-associated protein
    Species: Mus musculus [TaxId:10090]
    Gene: Cd2ap, Mets1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLQ0 (4-59)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d2krna1, d2krna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2krnA (A:)
    gsmgrqckvlfdyspqnedelelivgdvidvieeveegwwsgtlnnklglfpsnfvkele