PDB entry 2krm

View 2krm on RCSB PDB site
Description: RDC refined solution structure of the first SH3 domain of CD2AP
Class: signaling protein
Keywords: protein, SH3 domain, SIGNALING PROTEIN
Deposited on 2009-12-21, released 2011-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD2-associated protein
    Species: Mus musculus [TaxId:10090]
    Gene: Cd2ap, Mets1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2krma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2krmA (A:)
    vdyiveydydavhddeltirvgeiirnvkklqeegwlegelngrrgmfpdnfvkeik