PDB entry 2krf

View 2krf on RCSB PDB site
Description: NMR solution structure of the DNA binding domain of Competence protein A
Class: transcription
Keywords: Activator, Competence, DNA-binding, Transcription regulation, Two-component regulatory system, TRANSCRIPTION
Deposited on 2009-12-16, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein comA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU31680, comA, comA1, comAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2krfa_
  • Chain 'B':
    Compound: Transcriptional regulatory protein comA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU31680, comA, comA1, comAA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2krfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2krfA (A:)
    gshmssqkeqdvltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsr
    teavliaksdgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2krfA (A:)
    ssqkeqdvltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsrteav
    liaksdgvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2krfB (B:)
    gshmssqkeqdvltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsr
    teavliaksdgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2krfB (B:)
    ssqkeqdvltpreclilqevekgftnqeiadalhlskrsieysltsifnklnvgsrteav
    liaksdgvl