PDB entry 2kqy

View 2kqy on RCSB PDB site
Description: Solution structure of Avian Thymic Hormone
Class: metal binding protein
Keywords: metal-binding protein, parvalbumin, EF-HAND PROTEIN, Calcium, METAL BINDING PROTEIN
Deposited on 2009-11-24, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kqya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kqyA (A:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka