PDB entry 2kqx

View 2kqx on RCSB PDB site
Description: NMR structure of the J-domain (residues 2-72) in the Escherichia coli CbpA
Class: chaperone binding protein
Keywords: CbpA-J domain, Co-Chaperone, Escherichia coli, CHAPERONE BINDING PROTEIN
Deposited on 2009-11-19, released 2010-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Curved DNA-binding protein
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: cbpA, b1000, JW0985
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2kqxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2kqxA (A:)
gselkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsde
qrraeydqmwqhr

    Sequence, based on observed residues (ATOM records): (download) 
    >2kqxA (A:)
elkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsdeqr
raeydqmwqhr