PDB entry 2kqk

View 2kqk on RCSB PDB site
Description: Solution structure of apo-IscU(D39A)
Class: metal binding protein
Keywords: IscU, iron-sulfur cluster, scaffold protein, isc system, METAL BINDING PROTEIN
Deposited on 2009-11-10, released 2010-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NifU-like protein
  Species: Escherichia coli [TaxId:562]
  Gene: b2529, icsU, iscu, JW2513, nifU, yfhN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ACD4 (0-127)
    • engineered (38)
  Domains in SCOPe 2.08: d2kqka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kqkA (A:)
  maysekvidhyenprnvgsfdnndenvgsgmvgapacgavmklqikvndegiiedarfkt
  ygcgsaiassslvtewvkgksldeaqaikntdiaeelelppvkihcsilaedaikaaiad
  ykskreak