PDB entry 2kq7

View 2kq7 on RCSB PDB site
Description: Solution structure of the Autophagy-Related Protein Atg8
Class: protein transport
Keywords: Protein Transport, Autophagy, ubiquitin fold, Cytoplasmic vesicle, Lipoprotein, Membrane, Transport, Ubl conjugation pathway, Vacuole
Deposited on 2009-10-29, released 2010-05-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autophagy-related protein 8
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATG8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38182 (2-118)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d2kq7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kq7A (A:)
    gsmkstfkseypfekrkaeseriadrfknripvicekaeksdipeidkrkylvpadltvg
    qfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfgr