PDB entry 2kq3

View 2kq3 on RCSB PDB site
Description: Solution structure of SNase140
Class: Hydrolase
Keywords: Nuclease, Hydrolase
Deposited on 2009-10-26, released 2010-05-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2kq3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kq3A (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqllrkseaqakkeklniw