PDB entry 2kph

View 2kph on RCSB PDB site
Description: NMR Structure of AtraPBP1 at pH 4.5
Class: transport protein
Keywords: pheromone binding protein, navel orange worm moth, Amyelois transitella, PBP, TRANSPORT PROTEIN
Deposited on 2009-10-15, released 2010-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone binding protein
    Species: Amyelois transitella [TaxId:680683]
    Database cross-references and differences (RAF-indexed):
    • PDB 2KPH (0-141)
    Domains in SCOPe 2.07: d2kpha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kphA (A:)
speimkdlsinfgkaldtckkeldlpdsinedfykfwkedyeitnrltgcaikclsekle
mvdadgklhhgnarefamkhgaddamakqlvdlihgceksippnddrcmevlsiamcfkk
eihnlkwapnmevvvgevlaev