PDB entry 2kp2

View 2kp2 on RCSB PDB site
Description: Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
Class: isomerase
Keywords: THIOREDOXIN FOLD, ISOMERASE, Disulfide bond, Endoplasmic reticulum, Redox-active center
Deposited on 2009-10-06, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein disulfide-isomerase
    Species: Humicola insolens [TaxId:34413]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55059 (5-132)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2kp2a1, d2kp2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kp2A (A:)
    gplgspligeigpetysdymsagiplayifaetaeerkelsdklkpiaeaqrgvinfgti
    dakafgahagnlnlktdkfpafaiqevaknqkfpfdqekeitfeaikafvddfvagkiep
    siksepipekqeg