PDB entry 2koi

View 2koi on RCSB PDB site
Description: Refined solution structure of a cyanobacterial phytochrome GAF domain in the red light-absorbing ground state
Class: transferase
Keywords: phytochrome, gaf domain, phycocyanobilin, pcb, bacteriophytochrome, cyanobacterial phytochrome, kinase, phosphoprotein, transferase, protein structure initiative, psi-2, center for eukaryotic structural genomics, cesg, structural genomics
Deposited on 2009-09-22, released 2009-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Synechococcus sp. [TaxId:321332]
    Gene: CYB_2465
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2JIZ5 (0-169)
      • expression tag (170-171)
    Domains in SCOPe 2.07: d2koia1, d2koia2
  • Heterogens: CYC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2koiA (A:)
    ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
    arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
    slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqaelsl