PDB entry 2knz

View 2knz on RCSB PDB site
Description: NMR structure of CIP75 UBA domain
Class: protein binding
Keywords: Cytoplasm, Endoplasmic reticulum, Nucleus, Phosphoprotein, PROTEIN BINDING
Deposited on 2009-09-08, released 2010-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquilin-4
    Species: Mus musculus [TaxId:10090]
    Gene: Ubqln4, Ubin
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99NB8 (5-52)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2knza1, d2knza2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2knzA (A:)
    gplgsmpevrfqqqleqlnsmgfinreanlqaliatggdinaaierllgsqls