PDB entry 2knv

View 2knv on RCSB PDB site
Description: NMR dimer structure of the UBA domain of p62 (SQSTM1)
Class: protein binding
Keywords: Ubiquitin binding, Ubiquitin-Associated domain, Paget s disease of bone, helical bundle, dimer, PROTEIN BINDING
Deposited on 2009-09-04, released 2009-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-15, with a file datestamp of 2009-12-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sequestosome-1
  Species: Homo sapiens [TaxId:9606]
  Gene: SQSTM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13501 (2-51)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d2knva1, d2knva2
• Chain 'B':
  Compound: Sequestosome-1
  Species: Homo sapiens [TaxId:9606]
  Gene: SQSTM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13501 (2-51)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d2knvb1, d2knvb2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2knvA (A:)
  gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2knvB (B:)
  gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh