PDB entry 2knt

View 2knt on RCSB PDB site
Description: the 1.2 angstrom structure of kunitz type domain c5
Deposited on 1997-01-15, released 1997-05-15
The last revision prior to the SCOP 1.59 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.1489
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2knt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2knt_ (-)
    etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv