PDB entry 2knt

View 2knt on RCSB PDB site
Description: the 1.2 angstrom structure of kunitz type domain c5
Class: kunitz inhibitor
Keywords: kunitz inhibitor, extracellular matrix, connective tissue
Deposited on 1997-01-15, released 1997-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.149
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: collagen
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12111 (0-57)
  Domains in SCOPe 2.08: d2knta_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kntA (A:)
  etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv