PDB entry 2knf

View 2knf on RCSB PDB site
Description: Solution structure and functional characterization of human plasminogen kringle 5
Class: blood clotting
Keywords: Blood coagulation, Cleavage on pair of basic residues, Disease mutation, Disulfide bond, Fibrinolysis, Glycoprotein, Hydrolase, Kringle, Phosphoprotein, Polymorphism, Protease, Secreted, Serine protease, Thrombophilia, Tissue remodeling, Zymogen, antiangiogenic, BLOOD CLOTTING
Deposited on 2009-08-21, released 2009-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Gene: PLG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (3-85)
      • expression tag (0-2)
      • engineered (17)
    Domains in SCOPe 2.08: d2knfa1, d2knfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2knfA (A:)
    snadcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdg
    dvggpwcyttnprklydycdvpqcaa