PDB entry 2knb

View 2knb on RCSB PDB site
Description: Solution NMR structure of the parkin Ubl domain in complex with the endophilin-A1 SH3 domain
Class: protein binding
Keywords: Ubl, SH3, parkin, endophilin, Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum, Ligase, Membrane, Metal-binding, Nucleus, Postsynaptic cell membrane, S-nitrosylation, Synapse, Ubl conjugation pathway, Zinc-finger, Endocytosis, Lipid-binding, Phosphoprotein, SH3 domain, PROTEIN BINDING
Deposited on 2009-08-20, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase parkin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PARK2, PRKN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2knba_
  • Chain 'B':
    Compound: Endophilin-A1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sh3gl2, Sh3d2a, Sh3p4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2knbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2knbA (A:)
    gplgsmivfvrfnssygfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelqnhlt
    vqncdleqqsivhivqrpqrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2knbA (A:)
    mivfvrfnssygfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelqnhltvqncd
    leqqsivhivqrpqrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2knbB (B:)
    gsrrasvgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpi
    nyveilvalph
    

    Sequence, based on observed residues (ATOM records): (download)
    >2knbB (B:)
    dqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyveilval
    ph