PDB entry 2kn7

View 2kn7 on RCSB PDB site
Description: Structure of the XPF-single strand DNA complex
Class: hydrolase/DNA
Keywords: NER, XPF/ERCC1, HhH, Protein-ssDNA complex, HYDROLASE-DNA COMPLEX
Deposited on 2009-08-16, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair endonuclease XPF
    Species: Homo sapiens [TaxId:9606]
    Gene: XPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kn7a_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*ap*gp*tp*gp*gp*cp*tp*gp*a)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*gp*tp*gp*gp*cp*tp*gp*a)-3')
  • Chain 'D':
    Compound: DNA repair endonuclease XPF
    Species: Homo sapiens [TaxId:9606]
    Gene: XPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2kn7d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kn7A (A:)
    ekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaanakqlydfi
    htsfaev
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kn7D (D:)
    ekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaanakqlydfi
    htsfaev