PDB entry 2kn2

View 2kn2 on RCSB PDB site
Description: Solution structure of the C-terminal domain of soybean calmodulin isoform 4 fused with the calmodulin-binding domain of NtMKP1
Class: metal binding protein
Keywords: Calmodulin, Calmodulin-target complex, Soybean calmodulin, sCaM4, MAPK phosphatase 1, NtMKP1, Tobacco MKP1, METAL BINDING PROTEIN
Deposited on 2009-08-12, released 2009-08-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Glycine max [TaxId:3847]
    Gene: SCaM-4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39890 (3-74)
      • expression tag (0-2)
      • expression tag (75-91)
    Domains in SCOPe 2.06: d2kn2a1, d2kn2a2, d2kn2a3
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kn2A (A:)
    ghmdtdaeeelkeafkvfdkdqngyisaselrhvminlgekltdeeveqmikeadldgdg
    qvnyeefvkmmmtvrgggggngwsrlrrkfss