PDB entry 2kmy

View 2kmy on RCSB PDB site
Description: NMR Solution structures of fully oxidised cytochrome c3 from Desulfovibrio desulfuricans ATCC 27774
Class: electron transport
Keywords: Desulfovibrio Desulfuricans, ATCC 27774, multihaem cytochrome, dipolar shifts, fully oxidised, ELECTRON TRANSPORT
Deposited on 2009-08-05, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio desulfuricans [TaxId:876]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9L915 (0-106)
    • see remark 999 (70)
  Domains in SCOPe 2.07: d2kmya_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kmyA (A:)
  apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
  ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp