PDB entry 2kmn

View 2kmn on RCSB PDB site
Description: Solution structure of peptide deformylase complexed with actinonin
Class: hydrolase/antibiotic
Keywords: Peptide Deformylase, NMR, Actinonin, Hydrolase, Iron, Metal-binding, Protein biosynthesis, HYDROLASE/ANTIBIOTIC COMPLEX
Deposited on 2009-08-01, released 2009-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: def, fms, b3287, JW3248
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2kmna_
  • Heterogens: ZN, BB2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kmnA (A:)
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdyls