PDB entry 2kmk

View 2kmk on RCSB PDB site
Description: Gfi-1 Zinc Fingers 3-5 complexed with DNA
Class: DNA binding protein/DNA
Keywords: Tandem Repeat Zinc Finger Domain, Protein-DNA Complex, DNA-binding, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc, Zinc-finger, DNA BINDING PROTEIN-DNA COMPLEX
Deposited on 2009-07-30, released 2010-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein Gfi-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gfi1, Gfi-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2kmka_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*ap*tp*ap*ap*ap*tp*cp*ap*cp*tp*gp*cp*cp*tp*a)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*gp*gp*cp*ap*gp*tp*gp*ap*tp*tp*tp*ap*tp*g)-3')
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kmkA (A:)
sfdckicgksfkrsstlsthllihsdtrpypcqycgkrfhqksdmkkhtfihtgekphkc
qvcgkafsqssnlithsrkhtg

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.