PDB entry 2km4

View 2km4 on RCSB PDB site
Description: Solution structure of Rtt103 CTD interacting domain
Class: transcription regulator
Keywords: CTD-interacting domain, RNA polymerase II binding protein, phosphoprotein, transcription termination, DNA-binding, Nucleus, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-07-20, released 2010-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of Ty1 transposition protein 103
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RTT103, YDR289C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05543 (Start-130)
      • conflict (1)
      • expression tag (131-137)
    Domains in SCOPe 2.08: d2km4a1, d2km4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2km4A (A:)
    mafsseqfttklntledsqesissaskwlllqyrdapkvaemwkeymlrpsvntrrkllg
    lylmnhvvqqakgqkiiqfqdsfgkvaaevlgrinqefprdlkkklsrvvnilkernifs
    kqvvndierslaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2km4A (A:)
    afsseqfttklntledsqesissaskwlllqyrdapkvaemwkeymlrpsvntrrkllgl
    ylmnhvvqqakgqkiiqfqdsfgkvaaevlgrinqefprdlkkklsrvvnilkernifsk
    qvvndierslaaalehh