PDB entry 2klv

View 2klv on RCSB PDB site
Description: Membrane-bound structure of the Pf1 major coat protein in DHPC micelle
Class: membrane protein
Keywords: membrane protein, alignment, alpha helix, Capsid protein, Membrane, Transmembrane, Virion
Deposited on 2009-07-08, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein G8P
    Species: Pseudomonas phage Pf1 [TaxId:10871]
    Gene: VIII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2klva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2klvA (A:)
gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka