PDB entry 2kls

View 2kls on RCSB PDB site
Description: Apo-form of the second Ca2+ binding domain of NCX1.4
Class: metal binding protein
Keywords: sodium calcium exchanger, electrostatic switch, Ca2+ sensor, Ca2+ regulation, METAL BINDING PROTEIN
Deposited on 2009-07-08, released 2009-08-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sodium/calcium exchanger 1
    Species: CANIS FAMILIARIS [TaxId:9615]
    Gene: SLC8A1
    Database cross-references and differences (RAF-indexed):
    • PDB 2KLS (Start-163)
    Domains in SCOPe 2.04: d2klsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2klsA (A:)
    mshhhhhhagiftfeepvthvsesigimevkvlrtsgargnvivpyktiegtargggedf
    edtcgelefqndeivktisvkviddeeyeknktffleigeprlvemsekkggftiteeyd
    dkqpltskeeeerriaemgrpilgehtkleviieesyefkstvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2klsA (A:)
    hagiftfeepvthvsesigimevkvlrtsgargnvivpyktiegtargggedfedtcgel
    efqndeivktisvkviddeeyeknktffleigeprlvemsekkggftiteeyddkqplts
    keeeerriaemgrpilgehtkleviieesyefkstvd