PDB entry 2kl4

View 2kl4 on RCSB PDB site
Description: NMR structure of the protein NB7804A
Class: structural genomics, unknown function
Keywords: NB7804A, BACILLUS HALODURANS, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, UNKNOWN FUNCTION
Deposited on 2009-06-30, released 2009-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: BH2032 protein
  Species: Bacillus halodurans [TaxId:86665]
  Gene: BH2032
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KB96 (3-117)
    • leader sequence (0-2)
  Domains in SCOPe 2.08: d2kl4a1, d2kl4a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kl4A (A:)
  gshmevfaeylkgidhpdhrdrteeilswvaatfpnlepqmkwntpmfsnqgtfiigfst
  skhhlsvspeeigisqfadaiaqagysatkglfripwndpvhyellkqmiefniqdke