PDB entry 2kkq

View 2kkq on RCSB PDB site
Description: Solution NMR Structure of the Ig-like C2-type 2 Domain of Human Myotilin. Northeast Structural Genomics Target HR3158.
Class: structural protein
Keywords: unknown function, Actin-binding, Cell membrane, Cytoplasm, Cytoskeleton, Disease mutation, Immunoglobulin domain, Limb-girdle muscular dystrophy, Membrane, Muscle protein, Polymorphism, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, STRUCTURAL PROTEIN
Deposited on 2009-06-29, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myotilin
    Species: Homo sapiens [TaxId:9606]
    Gene: MYOT, TTID
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBF9 (10-115)
      • expression tag (0-9)
    Domains in SCOPe 2.07: d2kkqa1, d2kkqa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kkqA (A:)
    mghhhhhhshehkrapmfiykpqskkvlegdsvklecqisaipppklfwkrnnemvqfnt
    drislyqdntgrvtllikdvnkkdagwytvsavneagvttcntrldvtarpnqtlp