PDB entry 2kk6

View 2kk6 on RCSB PDB site
Description: Solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d
Class: transferase
Keywords: methods development, SH2, Proto-oncogene tyrosine-protein kinase FER, NESG, NMR, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Proto-oncogene, SH2 domain, Transferase, Tyrosine-protein kinase, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2009-06-15, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase FER
    Species: Homo sapiens [TaxId:9606]
    Gene: FER, TYK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16591 (11-115)
      • expression tag (0-10)
    Domains in SCOPe 2.07: d2kk6a1, d2kk6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kk6A (A:)
    mghhhhhhshmkplaeqdwyhgaiprieaqellkkqgdflvreshgkpgeyvlsvysdgq
    rrhfiiqyvdnmyrfegtgfsnipqlidhhyttkqvitkksgvvllnpipkdkkwi