PDB entry 2kje

View 2kje on RCSB PDB site
Description: NMR structure of CBP TAZ2 and adenoviral E1A complex
Class: transcription
Keywords: CBP, TAZ2, E1A, adenoviral, Acetylation, Activator, Bromodomain, Chromosomal rearrangement, Disease mutation, Host-virus interaction, Isopeptide bond, Metal-binding, Methylation, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Transferase, Ubl conjugation, Zinc, Zinc-finger, Alternative splicing, DNA-binding, Early protein, Oncogene
Deposited on 2009-05-27, released 2009-09-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2kjea_
  • Chain 'B':
    Compound: Early E1A 32 kDa protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03255 (3-41)
      • expression tag (0-2)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kjeA (A:)
spqesrrlsiqrciqslvhacqcrnancslpscqkmkrvvqhtkgckrktnggcpvckql
ialccyhakhcqenkcpvpfclnikhklrqqq

  • Chain 'B':
    No sequence available.