PDB entry 2kjc

View 2kjc on RCSB PDB site
Description: Solution structure of CzrA in the Zn(II) state
Class: transcription regulator
Keywords: CzrA, DNA-binding, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2009-05-27, released 2009-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CzrA protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: rzcA, CzrA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2kjca_
  • Chain 'B':
    Compound: CzrA protein
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: rzcA, CzrA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2kjcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kjcA (A:)
    maeqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kjcA (A:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhpke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2kjcB (B:)
    maeqyseintdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshql
    kllksvhlvkakrqgqsmiyslddihvatmlkqaihhanhpkesgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kjcB (B:)
    ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
    vkakrqgqsmiyslddihvatmlkqaihhanhpke