PDB entry 2kin

View 2kin on RCSB PDB site
Description: kinesin (monomeric) from rattus norvegicus
Class: motor protein
Keywords: motor protein, cytoskeleton
Deposited on 1997-04-28, released 1998-04-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2KIN (0-237)
    Domains in SCOPe 2.03: d2kin.1
  • Chain 'B':
    Compound: kinesin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2KIN (0-99)
    Domains in SCOPe 2.03: d2kin.1
  • Heterogens: SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kinA (A:)
    adpaecsikvmcrfrplneaeilrgdkfipkfkgeetvvigqgkpyvfdrvlppnttqeq
    vynacakqivkdvlegyngtifaygqtssgkthtmegklhdpqlmgiipriahdifdhiy
    smdenlefhikvsyfeiyldkirdlldvsktnlavhedknrvpyvkgcterfvsspeevm
    dvidegkanrhvavtnmnehssrshsiflinikqenvetekklsgklylvdlagsekv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kinB (B:)
    akninkslsalgnvisalaegtkthvpyrdskmtrilqdsldgncrttiviccspsvfne
    aetkstlmfgqraktikntvsvnleltaeewkkkyekeke