PDB entry 2ki6

View 2ki6 on RCSB PDB site
Description: The FGF1-S100A13-C2A hetero-hexameric complex structure: A component in the non-classical pathway for FGF1 secretion
Class: protein transport
Keywords: FGF1-S100A13-C2A hetero-hexameric complex, FGF1, S100A13, C2A, Calcium, Cell junction, Cytoplasmic vesicle, Glycoprotein, Lipoprotein, Membrane, Metal-binding, Palmitate, Phosphoprotein, Synapse, Transmembrane, Acetylation, Alternative splicing, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, PROTEIN TRANSPORT
Deposited on 2009-04-28, released 2010-03-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT1, SVP65, SYT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ki6a_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ki6b_
  • Chain 'C':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99584 (0-97)
      • see remark 999 (96-97)
    Domains in SCOPe 2.04: d2ki6c_
  • Chain 'D':
    Compound: Protein S100-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99584 (0-97)
      • see remark 999 (93)
    Domains in SCOPe 2.04: d2ki6d_
  • Chain 'E':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ki6e_
  • Chain 'F':
    Compound: Synaptotagmin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT1, SVP65, SYT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ki6f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ki6A (A:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
    ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
    rdlqsaek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ki6B (B:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvssd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ki6C (C:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ki6D (D:)
    maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
    ksldvnqdselkfneywrligelakeirkkkdlkirkk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ki6E (E:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvssd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ki6F (F:)
    eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
    ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
    rdlqsaek