PDB entry 2khr

View 2khr on RCSB PDB site
Description: Solution structure of Rv2377c, a MbtH-like protein from Mycobacterium tuberculosis
Class: biosynthetic protein
Keywords: siderophores, mycobactin, MtbH-like, 2-hydroxyphenyloxazoline, tuberculosis, BIOSYNTHETIC PROTEIN, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-04-10, released 2009-05-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein mbtH
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: mbtH, MT2445.1, MTCY27.03, Rv2377c
  Database cross-references and differences (RAF-indexed):
  • Uniprot O05821 (3-73)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d2khra1, d2khra2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2khrA (A:)
  gshmstnpfdddngaffvlvndedqhslwpvfadipagwrvvhgeasraacldyveknwt
  dlrpkslrdamved