PDB entry 2khl

View 2khl on RCSB PDB site
Description: Refined solution structure of Methanosarcina thermophila protein MC1
Class: DNA binding protein
Keywords: DNA-binding protein, alpha and beta, DNA-binding, DNA BINDING PROTEIN
Deposited on 2009-04-08, released 2009-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromosomal protein MC1
    Species: Methanosarcina thermophila [TaxId:2210]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2khla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2khlA (A:)
sntrnfvlrdedgnehgvftgkqprqaalkaanrgsgtkanpdiirlrergtkkvhvfka
wkeivdapknrpawmpekiskpfvkkeriekle