PDB entry 2khj

View 2khj on RCSB PDB site
Description: NMR structure of the domain 6 of the E. coli ribosomal protein S1
Class: ribosomal protein
Keywords: ribosomal protein S1, OB fold, Acetylation, Phosphoprotein, Ribonucleoprotein, Ribosomal protein, RNA-binding
Deposited on 2009-04-07, released 2009-10-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S1
    Species: Escherichia coli [TaxId:562]
    Gene: rpsA, ssyF, b0911, JW0894
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AG67 (21-108)
      • expression tag (20)
    Domains in SCOPe 2.04: d2khja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2khjA (A:)
    mgsshhhhhhssglvprgshmfnnwvalnkkgaivtgkvtavdakgatveladgvegylr
    aseasrdrvedatlvlsvgdeveakftgvdrknraislsvrakdeadek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2khjA (A:)
    mfnnwvalnkkgaivtgkvtavdakgatveladgvegylraseasrdrvedatlvlsvgd
    eveakftgvdrknraislsvrakdeadek