PDB entry 2kgb

View 2kgb on RCSB PDB site
Description: NMR solution of the regulatory domain cardiac F77W-Troponin C in complex with the cardiac Troponin I 144-163 switch peptide
Class: contractile protein/ca binding protein
Keywords: TROPONIN C, TROPONIN I, switch peptide, cNTnC, TnI144-163, TFE, Acetylation, Calcium, Cardiomyopathy, Disease mutation, Muscle protein, Polymorphism, Actin-binding, Phosphoprotein, CONTRACTILE PROTEIN/CA BINDING PROTEIN COMPLEX
Deposited on 2009-03-07, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1, TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-88)
      • engineered (76)
    Domains in SCOPe 2.07: d2kgbc_
  • Chain 'I':
    Compound: Troponin I, cardiac muscle
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kgbC (C:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdewlvmmvrcmkdds
    

  • Chain 'I':
    No sequence available.