PDB entry 2kfn

View 2kfn on RCSB PDB site
Description: klenow fragment with bridging-sulfur substrate and manganese
Class: transferase/DNA
Keywords: complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex
Deposited on 1998-07-01, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: klenow fragment of DNA polymerase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00582 (0-604)
      • engineered (0)
    Domains in SCOPe 2.07: d2kfna1, d2kfna2
  • Chain 'B':
    Compound: 5'-d(*gp*cp*tp*tp*ap*(us1)p*g)-3'
  • Heterogens: ZN, MN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kfnA (A:)
    misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpggapstseevleelaldypl
    pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
    eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
    lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
    rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
    dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
    wdqah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kfnA (A:)
    misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvi
    leyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegr
    rirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfglple
    tvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertra
    qakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawl
    qaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqa
    h
    

  • Chain 'B':
    No sequence available.