PDB entry 2kfl

View 2kfl on RCSB PDB site
Description: Tammar Wallaby Prion Protein (121-230)
Class: unknown function
Keywords: Tammar Wallaby PrP, Cell membrane, Membrane, Prion, UNKNOWN FUNCTION
Deposited on 2009-02-24, released 2009-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Macropus eugenii [TaxId:9315]
  Gene: PRNP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q58YZ3 (2-111)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d2kfla1, d2kfla2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kflA (A:)
  gsvvgglggymlgsamsrpvmhfgneyedryyrenqyrypnqvmyrpidqygsqnsfvhd
  cvnitvkqhttttttkgenftetdikimervveqmcitqyqneyqaaqryyn